PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G10250.1
Common NameLOC102706597
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 235aa    MW: 26042.6 Da    PI: 6.5084
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G10250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45e-1895149256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  OB10G10250.1  95 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVCLAKQLNLRPRQVEVWFQNRRARTK 149
                   78889************************************************98 PP

2HD-ZIP_I/II124.35.5e-4095183189
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                   +kk+rl+keq++lLE+ F+e+++L+p++Kv la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL++e ++Lr+
  OB10G10250.1  95 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVCLAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCETLTEENRRLHRELQQLRA 183
                   69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-1885152IPR009057Homeodomain-like
PROSITE profilePS5007116.81191151IPR001356Homeobox domain
SMARTSM003894.6E-1493155IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-1795149IPR009057Homeodomain-like
PfamPF000462.0E-1595149IPR001356Homeobox domain
CDDcd000863.58E-1595152No hitNo description
PROSITE patternPS000270126149IPR017970Homeobox, conserved site
PfamPF021831.4E-10151184IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.1E-20151192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MAQEDVGLAL GLSLGSGAHD VLLREPPQAT CTLEPSLTLS LPADSGLTTP VIMPAAAVKR  60
ELREEEEEEE EALYNYSVAS SSAVAAEEEE GCNSRKKLRL TKEQSALLED RFKEHSTLNP  120
KQKVCLAKQL NLRPRQVEVW FQNRRARTKL KQTEVDCELL KRCCETLTEE NRRLHRELQQ  180
LRALTHPFFI PAATLSICPS CDRLAAGPSP TTAVDRPNNN KAAGFFNPFA KSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19399SRKKLRL
2143151RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0989841e-106FP098984.1 Phyllostachys edulis cDNA clone: bphylf047o12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006661591.11e-171PREDICTED: homeobox-leucine zipper protein HOX15-like
SwissprotQ7G7372e-88HOX15_ORYSJ; Homeobox-leucine zipper protein HOX15
TrEMBLJ3N0H71e-171J3N0H7_ORYBR; Uncharacterized protein
STRINGOB10G10250.11e-171(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.19e-63HD-ZIP family protein